SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma13g17270.1|PACid:16290589 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma13g17270.1|PACid:16290589
Domain Number 1 Region: 64-215
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-40
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 976-1041
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000157
Family PB1 domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma13g17270.1|PACid:16290589
Sequence length 1091
Sequence
VAASMQKEADFIPSYPNLPSKLICMLHNVALHADPETDEVYAQMTLQPVNKYEKEAILAS
DMGLKQNRQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLLEIESQEVCMLTDYSMQ
PPAQELVAKDLHDNTWAFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDEKQHL
LLGIRRANRQQPALSSSVISSDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVVPLA
KYNKVTYTQVSLGMRFRMMFETEESGVRRYMGTITGINDLDPVRWKSSQWRNIQVGWDES
TAGERPSRVSIWEIEPVVTPFYICPPPFFRPKFPRQPGMPDDESDMENAFKRAVPWLGDD
FGMKDASSSIFPGFSLVQWMSMQQNNQLTAAQSGCFPSMLPFNTLQGNLSTDDPSKLLSF
QAPVLSTPSLQLNKPNLPNQINQLQQSPVSWPQQQQLQQQQQLQQQQQQQQQQQQQLQQQ
QQQQLQSLLQVPMNHLQQQREQQLPEPQNLPLWQQLPQQLGQQPQKQQSSQHATIMNNGV
VASNQITNQFSQQPMAYGQLQQQQLLSGGIQSATKNTLPLTSLPQDSQFQQQIDQQASLL
QRQQQQQQTQLQQSPLQLLQQNLPQRAPQQPPATQMLQQNPSEQQLHLQLLQKLQQQQQH
QQRLLSTSTPLLLSQLLQQQNTHQQNQQLPQPLPPISQHQPQQLGNNAFSTEKLLNSNNL
SSSLMQSQKLSMNHPQNTQKSLTITRAPSTLTEGDAPSCSTSPSTNNCQVTPPNLLKRNQ
QLPATLRGSLIVEPTSNLIQELHSKPDTQIKQEFLNVKGPDQLKYKGTITDQLEASSGTS
YCLDPPGNVQQNLPLSNFCMEGDVQSHPRNSLPFDSNLDGLTPDTMLLTGYDSQKDLQNL
LSNYGGAPREIETELSTADISSQSFGVPNMPFKPGCSSDVGINDTGVLNNNNGLRANQTP
RMRTYTKVQKRGSVGRCIDVTRYKGYDELRHDLARMFGIEGQLEDPLRTDWKLVYVDHEN
DILLVGDDPWDEFVSCVQSIKILSSAEVQQMSLDGDLGGNVPIPNQAYSGTDSGNAWRGQ
YEDNSAASFNR
Download sequence
Identical sequences Glyma13g17270.1|PACid:16290589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]