SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma13g24240.1|PACid:16291395 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma13g24240.1|PACid:16291395
Domain Number 1 Region: 133-253
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-43
Family B3 DNA binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma13g24240.1|PACid:16291395
Sequence length 719
Sequence
MAGLIDLNNATEDDETPSSGSSSSSSSSTVCLELWHACAGPMISLPKKGSVVVYFPQGHL
EQHLHDFPLPASANIPSHVFCRVLDVKLHAEEGSDEVYCQVVLVPESEQVQQKLREGEFD
ADGEEEDAEAVMKSTTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQQRPSQEL
VAKDLHGQEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGEDGELRLGIRR
AAQLKSGSTFSALSGQQGSPTSLMDVVNALSARCAFSIHYNPRVSSSEFIIPIHRFVKSL
DYSYSAGMRFRMRFETEDAAERRFTGLIVGIADVDPVRWPGSRWRCLMVRWDDLEATRHN
RVSPWEIEPSGSASTANNLMSAGLKRTKIGLPSAKLDFPVSNAIGTSDFGESLRFQKVLQ
GQEMLGVNTTYDSFNAQSHQLSDLRRCYPGSNYPRIAATGNSIGISQVSSNVSNNGIGFS
ESFRFQKVLQGQEILPSQPYGRALSVDEACGNGRFGLFDGFQAMRSRNGWSSHVSNNSSH
LHPPVPSGQVSSPSSVFMFQQAVNPVLNSDYNNQIGQVMGDKVHQRVSYASEVKGGKFVS
TPYEPLLRGLSQEGTNSFGLSNFHNQLDSSRSHDSVSVLRASQELVPSCKSRCRVFGFSL
TEGAPVASKEATDSSAVACAGPSFTRHVEDDFHPGHSLRSKAVASYCTKSQFLPNEYNA
Download sequence
Identical sequences Glyma13g24240.1|PACid:16291395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]