SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma14g03510.1|PACid:16294225 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma14g03510.1|PACid:16294225
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-16
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 60-187
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000115
Family BTB/POZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma14g03510.1|PACid:16294225
Sequence length 590
Sequence
MDNSYDSSSSLSFVSSHLSHGSSNHNVSSTTSNEHGENIEILSLNKLSGSLEKLLIEVEY
DYSDAEILIEDIPVGIHRCILASRSPFFHELFKKGTDGSGKEGKPRYLMSDLMPYGTVGY
QAFQVFLYYLYTGRLKASPTEETTCVDETCIHVACRPAINHALELMYASATFQMKELVLL
FQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSRCIQRVARSDFDNTSLEKELPHEVLT
EIKSLRLSFQPESTPNAMEAESLNEKSIRRIHKALDSDDVELLKLLLNESSVTLDDAYAL
HYACAYSDSKVIQEVLSLGMADILRRNSRGYTVLHVAARRKDPSILVALLNKGARASDTT
PDGQTALAICQRLTRCKDYHEKTVQCKESNKDRLCVDVLEREMRRNSMTVNMSVSSQLTA
DDLHMRLDYLEDRVAFARLLFPAEARVAIENAEADSSSLYANSSALKVTNGNPKEVDLNE
SPSARTRKLQLRLHALMKTVENGRRFFPHCSEVLDKFLEDDEMPDVFFLEKGSEEEQRIK
KARFMELKDDVQKAFHKDMAENNHSGFSSTVSSSSSSTRREGLNHRVRRK
Download sequence
Identical sequences I1M705
Glyma14g03510.1|PACid:16294225 XP_014622707.1.40590 XP_014622708.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]