SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma14g38940.1|PACid:16296878 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma14g38940.1|PACid:16296878
Domain Number 1 Region: 112-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-49
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 715-791
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000638
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma14g38940.1|PACid:16296878
Sequence length 843
Sequence
MKLSTSGLGQQGHEGGEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTNR
EVDGHIPNYPSLPPQLVCQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDTFLPMELGVP
SKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEWKF
RHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSV
LSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRVSVGMRFR
MLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPL
TTFPMYPSLFPLRLKRPWHPGTSSFHDGRDEATNGLMWLRGGPGDQALNSLNFQGSGLLP
WMQQRMDPTLLGNDHNQQYQAMFASGLQNLGSGDLMRQQMMNFQQPFNYLQQSGNPNLPL
QLQQPQAVQQSVSSNNILQPQAQVLAENLSQHLQKSHNNREDQTQQQQHTYQDTVLLQSD
QLHQRQHSGLPSPSYSKPDFLDSSMKFPASVSPGQNMLGSLCPEGSGNLLNLSRSSQSML
TEQLPQQSWAPKFTPLQINAFGNSMQHVQYSGKDTAMVPPHCNPDSQNPILFGVNIDSSG
LLLPTTVPRYTTASAEIDASAMPIGESGFQSPLYPCVQDSSELVQSAGQVDPQNQTRTFV
KVYKSGSVGRSLDISRFSSYHELREELAQMFGIEGKLEDPLRSGWQLVFVDRENDVLLLG
DDPWESFVNNVWYIKILSPEDIHKMGEQAVESLGPSSGHRLNSTGADSHEIVSGLPSIGS
LEY
Download sequence
Identical sequences I1MBP7
XP_006596491.1.40590 Glyma14g38940.1|PACid:16296878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]