SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma15g13320.1|PACid:16298647 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma15g13320.1|PACid:16298647
Domain Number 1 Region: 261-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-16
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 60-189
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000018
Family BTB/POZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma15g13320.1|PACid:16298647
Sequence length 590
Sequence
MAYSAEPSSSLSFTSSSHLSNGSVSHNICSSYGSDPGPNLEALSLSKLSSNFEQLLIETD
CDYSDADIVVEGISVSVHRCILASRSKFFHELFKREKGSSEKEGKLKYNMSDLLPYGKVG
YEAFLIFLGYVYTGKLKPSPMEVSTCVDSVCAHDACRPAINFAVELMYASYIFQIPEFVS
LFQRRLLNFIGKALVEDVIPILTVAFHCQLSQLVNQCIDRVARSDLDQISIDQELPNELS
QKVKLLRRNPQRDVENDASIVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEANA
LHYAAAYCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTKGACASDL
TFDGQSAVSICRRLTRPKDYHAKTEQGKETNKDRICIDVLEREMWRNPLAGDACMSSHTM
ADDLHMKLLYLENRVAFARLFFPSEAKLAMDIAHAETTSEFAGLSASNSKGSNGNLREVD
LNETPIVQSKRLFSRMEALMKTVEMGRRYFPHCSEVLDKFMEDDLPDLFYLEKGTNEEQR
IKRTRFMELKDDVHKAFNMDKAEFSRSGISSSSSSSSLRDSVVHYKARKV
Download sequence
Identical sequences B8XQT7
Glyma15g13320.1|PACid:16298647 NP_001238674.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]