SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma16g26010.1|PACid:16302916 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma16g26010.1|PACid:16302916
Domain Number 1 Region: 74-316
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000000000013
Family Cystathionine synthase-like 0.01
Further Details:      
 
Weak hits

Sequence:  Glyma16g26010.1|PACid:16302916
Domain Number - Region: 633-727,766-793
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00201
Family Cystathionine synthase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Glyma16g26010.1|PACid:16302916
Sequence length 812
Sequence
MEAHFTLSRSLARLHAQREFLRATALAAERIFESQEEIPSLREAFAKFLTMYPKYQSSEK
VDQLRSDEYSHLSPKVCLDYCGFGLFSFVQTIHYWESSTFSLSEITANLSNHALYGGAER
GTVEHDIKTRIMDYLNIPENEYGLVFTVSRGSAFKLLADSYPFHTNKKLLTMFDHESQSI
AWMAQSAREKGAKVHSAWFKWPTLKLCSTDLRKQISNKKKRKKDSATGLFVFPVQSRVTG
AKYSYQWMALAQQNNWHVLLDAGSLGPKDMDSLGLSLFRPDFIVTSFYRVFGYDPTGFGC
LLIKKSVMQSLQNQSGCTGSGMTSETRQGTQLPAFSGAFTSAQVRDVFETEMDQDSSERD
GTSTIFEETESISVGEVIKSPVFSEDESSDNSFWIDLGQSPLGSDSAGQSNKHKIASPLP
PFWFNGRRNQKQHSPKPTSKMYGSPMYNDREVNLGAHEDRHVLSFDAAVLMSQELDRVKE
VPEEEHVEEVDHYSRNGNGSDHLHVNEILEEPGTSGVVNNGSWLDSTSLARHQSLENGST
SEICPDVKESAIRRETEGEFRLFFGLEENEANSRGRRVSFSMEDNHKEYLSQTLEPGDMS
ATSFDDEEVTSDGEYGDGQDWGRKEPEIICRHIDHVNMLGLNKTALRLRFLINWLVTSLL
QLKLPASDGCEKASLVQIYGPKIKYERGAAVAFNVRDRSRGLINPEIVQKLAEKEGISLG
LGFLSHIQILDGSRQHRGALNLEDTTLCRPMENGRRDGKGSSFVRLEVVTASLGFLTNFE
DVYKLWAFVAKFLNPTFIREGGLPTVQEGLET
Download sequence
Identical sequences Glyma16g26010.1|PACid:16302916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]