SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma17g14140.1|PACid:16305527 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma17g14140.1|PACid:16305527
Domain Number 1 Region: 167-345
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000000525
Family Cystathionine synthase-like 0.027
Further Details:      
 
Weak hits

Sequence:  Glyma17g14140.1|PACid:16305527
Domain Number - Region: 430-521,563-590
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00867
Family Cystathionine synthase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma17g14140.1|PACid:16305527
Sequence length 607
Sequence
MHPSRAEAAASQPCFNGCFPSPLLASEKSHRTTSSKPKVVNNNNVTSSHDDFVAATSSTL
HPHTNFTNHESLPSLQDSYISFTKAFPQFSTTTSEVDQIRALEYHHLSNHSNACFDYTGY
GLFSYYQQQRISYSYPTIASSSSSSFPYFRSDASFFDISYKSVNLQSQVLYGGHESELES
RIRKRIMSFMNVSEAEYTLVFIANEVSAFKIVADSFQFQNNRQLLTVYDHSSEALDVMIE
SCKKQGVHVLSAEFSWPNLRLEWRKLKKMVTKNKREKRSKGGLFVFPIHSRVTGAPYSYV
WMSMAQENGWRVMLDVCGLKPKEMGTLGMSLFKPDFMVCSFYKFVTKSSVSSLKDPGYAT
SIGIISLVPAYRHETDEQVVIETDEADHQQQDGASSATEIEELNIIPFDSSRDTNRLGTK
NEGFEIHCRGLDHADSVGLLLISSRTKYLVNWLVNALMSLKHPHHENSISLIRIYGPKIS
SIRGPAVAFNVFDWKGEKCDPALVQKLADRNNISLGSSYLRNIRFSDKNEEERHWASETT
RGCSEVEGLGLSKKKTRSHEPGIFVVTAALGLLTNFEDIYRLWAFLSRLLKYECVASYCS
PARYFSQ
Download sequence
Identical sequences Glyma17g14140.1|PACid:16305527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]