SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma18g22670.1|PACid:16309256 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma18g22670.1|PACid:16309256
Domain Number 1 Region: 37-149
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000334
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma18g22670.1|PACid:16309256
Sequence length 156
Sequence
MRRSTSNFRTSRRRFCSNKNEEEMNKGVSTTLKLYDDPWKIKKTLTDSDLGILSRLSLAT
DLVKKQILPMLGADHARAAETEEGTPVRVWDMDTKSMHQLVLKRWSSSKSYVLIAKWNQD
FVRRRDLKKGDEIGFHWDPYNCVFNFCVLKRAMPEN
Download sequence
Identical sequences Glyma18g22670.1|PACid:16309256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]