SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma18g38490.1|PACid:16309902 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma18g38490.1|PACid:16309902
Domain Number 1 Region: 519-615
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-24
Family B3 DNA binding domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma18g38490.1|PACid:16309902
Sequence length 662
Sequence
REMWLNSDQDEFLGVNDASMFYADFPPLPDFPCMSSSSSSSSALPFPVKTMTCSTRTTTT
TTTSSSSSSSSWAVLKSDAEEDAEKNHCNRYMHDQLDATLSSTASMEVSQQKNLDPGLGG
PVGECMDDVMDTFGYMELLEANDFFDPASIFQNEDNENPLQGRTEEVDHQVPVCEEIQGD
EEGGDGVGVDDEMSNVFLEWLKSNKDSVSANDLRNVKLKKATIESAARRLGGGKEAMKQL
LKLILEWVQTSHLQNKRRKENNGSSISSALQAQFPDPSVQNNQNTQSGSFSPESNACFNN
QTPWLSPQTFATDQAPLMVPPQQFQQPMVGNNPYQPGAEQYHMLESAHSWPHSQFNVACH
YSQSFGDNNGIFPHGGFGGGYGNNQYPYQFFHGPGDTLMRLGPSATKEARKKRMARQRRF
LSHHRHHNGNYQNSGSDPHARLGGGDNCTTGLAAPHHANPTANWMYWQAMTGGAAGPLAP
PAEPPAVDRSALQTQNCHQSRVASDRRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKK
EAETHLPELEARDGISITMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEG
DFIVIYSDVKCGKYMIRGVKVRQQGVKPETKKVGKSQKNQHGTGTNASTTASCPAMEAVK
DX
Download sequence
Identical sequences Glyma18g38490.1|PACid:16309902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]