SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma19g27950.1|PACid:16313030 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma19g27950.1|PACid:16313030
Domain Number 1 Region: 10-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.55e-25
Family B3 DNA binding domain 0.0023
Further Details:      
 
Domain Number 2 Region: 163-259
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000824
Family B3 DNA binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma19g27950.1|PACid:16313030
Sequence length 261
Sequence
MASTFPHQLQVKPIHFFKIITAQNLQDGKLMIPNKYVDKYGEGLPNSLFLKTPNGTEWNF
NLKKRDGKIWFQKGWKEFAEYHSLAHGHLLVFRRHRTSHFQVHIFDLSALEIHYPSKGRE
GKMSPNHQGNNPRNEENLEYHKPEKSKVVVANQIIALDLKSSLKPCNPFFLVVMHPSYIH
SNGIETQNNYFSFSWHSLLTKFCRRHFGLLNKKRHINLQKTKNKINFRLTSGWKAFVKDN
NLKVGNVCTFELIDGTKLTFL
Download sequence
Identical sequences Glyma19g27950.1|PACid:16313030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]