SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma19g39340.1|PACid:16314303 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma19g39340.1|PACid:16314303
Domain Number 1 Region: 67-206
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-36
Family B3 DNA binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  Glyma19g39340.1|PACid:16314303
Domain Number - Region: 487-548
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00245
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma19g39340.1|PACid:16314303
Sequence length 556
Sequence
VAAYTQHQQDGHMEIPVYDLPSKILCKIMHIELKAEAFSDEVYAQVTLVPALKQDNLRLE
VEENDQIPSITTTYTFSKILTPSDTSTHGGFSVPKKHADECFPPLDMTQQTPAQEIVAKD
LNGFEWHFRHIYRGKPKRHLLTSGWSTFVNAKKLVAGDSCIFVRAESGEIRVGIRRATEH
LSNVSQSSSLISGHSMQLGILASASHAVSSGTMFIVYYHPWTNPFEFIVPLRTYLKSTVP
DYPIGMRVQMQHEVEESLRRHAGTIIGHEDIDKIRWPGSEWRCLKVQWDAVLDDKMNPER
VCPWWIEPLESAKEKKQRSLPGISSFGMHDGQNSAGPSSQTRREDRDLQGQDYSGIHSAQ
PLQRAPPTDVIHPSKVPIRGSRFGKENPNQLPFPMQDLSITSSNLSSIGSESLGWPSTES
RNENDVPFGQPGSCSTFKLFGVSLIDRSSELPSLQSAAFNKTSSLLSNPPMRVAPGKTCK
KQVLKLGTALGRAVDLARFHGYTELIAELDSMFEFRGSLINESSGWHVTCMDDDGDMMQL
GDYPWQLSSGETNSII
Download sequence
Identical sequences Glyma19g39340.1|PACid:16314303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]