SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma20g24220.1|PACid:16316639 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma20g24220.1|PACid:16316639
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000432
Family B3 DNA binding domain 0.0087
Further Details:      
 
Domain Number 2 Region: 161-240
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000051
Family B3 DNA binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Glyma20g24220.1|PACid:16316639
Sequence length 246
Sequence
RIPRSFVNKCWEGMSNPVVLLLRNGAEWKVKWKKLDVDVWLIDDWKEFADFCCLDQDHLL
VFKYMGKSRFQVVIFYQNGLEMQYPLMEETIDGNSLCQPKRAKSPLPFSSSIKKVKTNPR
KEPSRGRRRRIMCSNSRAIKRDELLQDTESSTALERAKAFRTDNPSFIRAMGKSYIERSV
LAISLQKTNKRRMTIHSSGQILLSIGWMDFVKDNNLKIGNVCVFEQIKKPGISFRVVIFR
DPEESX
Download sequence
Identical sequences Glyma20g24220.1|PACid:16316639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]