SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Glyma20g29360.1|PACid:16317253 from Glycine max v109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Glyma20g29360.1|PACid:16317253
Domain Number 1 Region: 129-372
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.24e-18
Family Cystathionine synthase-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Glyma20g29360.1|PACid:16317253
Sequence length 653
Sequence
MQYLGQNEASLACPHGCCPTSLLFNPPPPPPLQTQNTTTKPRNSSAECRHSFAATTASSI
FPNTKFTNHESLPSLHESFSEFKKVYPQYSETDQVDHVRDKEYYHLSFSNQSCLDYIGIG
LFSYYQRQHHHDTSKTQLASSSTPPSPPQYSDNIPFFSISYKTGNLKTLLLHGGQESEFE
SAMRRRIMKFLNISENDYFMVFTANRTSAFKLVADSYPFQSSKKLLTVYDYESEAVEAMI
SCSERRGAKAMSAEFSWPRLRIQSTKLRKMIVSKRKKKKKRGLFVFPLHSRVTGARYPYL
WMSIAQENGWHVLIDACALGPKDMDSFGLSLFQPDFLICSFYKVFGENPSGFGCLFVKKS
AITTLESSSCAGIVNLVPDRLLLHPSEDKDSSKQKPLSILQEQDLSSLSSFSGRIQTSQA
IKVEQELSELQIIAAPAKPKQGSGRVEAKGPVESLQSKKAQDGSENGGFNIDCRCLDQVD
SLGLIMITNRTRYLINWLVNSMMKLKHPNAEGVPLVKIYGPKVKFDRGPALAFNVFDWKG
EKVEPVLVQKLADRNNISLSYGFLHHIWFADKYAEDKGKVLQTKEGRVQGVITNKKKDRD
KLGVTVVTAALSFLANFEDVYKLWTFVARFLDADFVEKERWRYTALNQKTIEV
Download sequence
Identical sequences I1NGP3
Glyma20g29360.1|PACid:16317253 XP_003555367.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]