SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Crypa1|71952|fgenesh1_pg.C_scaffold_5000575 from Cryphonectria parasitica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Crypa1|71952|fgenesh1_pg.C_scaffold_5000575
Domain Number 1 Region: 49-202
Classification Level Classification E-value
Superfamily E set domains 0.0000217
Family Arrestin/Vps26-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Crypa1|71952|fgenesh1_pg.C_scaffold_5000575
Sequence length 795
Sequence
MVPLPGNGDPRIALEDQPSSRSFFSRFALPIRSRNTRNIVEFYIRPAEPHRKYSAGDAVR
GAVILAVVKAIDVTHLTVALRGSVRVYKNANAANEPVSNVDLASDGVSQFRFLGNGYASL
FQDEQVLCADGSLPAGKYEFGFELVFPDHGLPSSIEFERGTIAYNITATLTRPNAMSPTA
TCERKVDLVQQVDVGPLLPPQPRTIYLEPISKKAKRKKPTASTVSERQQNNPGYENGPAE
TSSDLDSTRAVESSTDGSNGAEEASQDVQQNPRSPVHSDLRSEVSGDSAVSNGSRGAELS
QVASLGTVPANGGRKAASGEKTIVATIELMKGGCLPGDTLPIRVNIQHTKPIRSMHGVIV
TLYRQGRVDSAPPASLFKHLSKEEMRKLEKEEYYPKSKTGLGGLSLTSAGSCSVFRKDLS
QSFSPLIVDPGTFTTSINTSVRVPENAFPSIKGVPGEMISFKYRLEVIVDLGGKLSNAIQ
IGQHTRVGAGGGLSASTRDLNAGVASFDGSLVNTDTVKREKGVIFDSFEVVVGTTDSSRR
GKAVGPAPTTHTKYYDSGAYAENGQWAGGQEDENHGAEDVYHHEYPPYPPEPVTQYPYWT
GGHREPPQPSAPHYIPPPELPDESALSEKERIRRAEQRLLPSQPHQQPPTPTAGPALPVD
ADGAGPSTLAASSLPPLHGDAAGPSAPTLDDLAADSLTPGATPMDDKQELERQRLLAEAS
APPEFPRDYDAGVGSSTAAGPSAPLSAAVDDGDEPSAPTLTEEDEYGPQFTYNDAAGSSS
RPPVPPTEPLPAYQR
Download sequence
Identical sequences jgi|Crypa1|71952|fgenesh1_pg.C_scaffold_5000575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]