SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Crypa1|91373|estExt_Genewise1Plus.C_41245 from Cryphonectria parasitica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Crypa1|91373|estExt_Genewise1Plus.C_41245
Domain Number 1 Region: 41-765
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.81e-250
Family Motor proteins 0.0000000000453
Further Details:      
 
Domain Number 2 Region: 1063-1152
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-23
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Crypa1|91373|estExt_Genewise1Plus.C_41245
Sequence length 1219
Sequence
MGITNRRKDKGAKHGGAAAASGGGHAGSGGARPKKATFETTKKKEIGVSDLTLLSKVSNE
AINDNLKKRFEGAEIYTYIGHVLVSVNPFRDLGIYTEQVLDSYRGKNRLEMPPHVFAIAE
SAYYNMKAYSENQCVIISGESGAGKTEAAKRIMQYIANVSGGESGDIQKVKDMVLATNPL
LESFGNAKTLRNNNSSRFGKYLQIHFNTQGEPIGADITNYLLEKTRVVGQITNERNFHIF
YQFTKGASQQHRELFGIQKPETYVYTSRSKCLDVDGIDDLAEFQDTLNAMKIIGLSQAEQ
DNIFRMLAAILWTGNLVFREDDDGYAAVSDQSVVDFLAYLLEVDAQSLVKAITIRILTPR
NGEVIESPANTAQATATRDALAKAIYNNLFDWIVERVNQSLKARQAASNSIGILDIYGFE
IFEKNSFEQLCINYVNEKLQQIFIQLTLKAEQEEYAREQIKWTPITYFDNKVVCDLIESI
RPPGIFSAMKDATKTAHADPAACDRTFMQSINGMSNANLTPRQGSFIIRHYAGDVSYTVD
GITDKCKDQLLKGVQNLFQRSQNKFIHTLFPHQVDQDNRKQPPSAGDRIRASANALVETL
MKCQPSYIRTIKPNENKSATEYNVPNVLHQIKYLGLQENVRIRRAGFAYRQSFEKFTDRF
FLLSPATSYAGEYTWSGSYDAAVKQILKDTSIPQEEWQMGVTKAFIKSPETLFALEHMRD
RYWHNMATRIQRMWRAYLAYRAESATRIQRFFRKKRTGAEYLQLRDQGHRLLQNRKERRR
FSLLGSRRFLGDYLGINATTGPGSQVRNAIGLGTNEKAVFSSRGEILEAKFGRSSKPSPR
ILIVTNSKFYIVSQMLNNGQLQIAVERSVPNGAIKFIGTSTARDDWFSLGVGSPQEPDPL
LNCVLKTELFTQMQRVMVGGFNLKIGETIEYAKKPNKIQLVKVLKDSPTPVDFYKSGAVH
TQPGEPSNSLSRPMPKAKPVPPRPITRGKLIKPGGPNGRPSRIMNTRTPQPRPGAGAAAS
AAAAAPRPVPVPKAATSRPVPTPAAIPSHTRNTSAASGTRVPPPPPPAAPPAKAKIMAKV
LYDFAGTKENELTIRAGDLVEVIQKENNGWWLAKNASGQAWVPAAYVEEQAPAPPPATSR
APPPPPNGRAKPAAPTPPARPGKKPVALQARDSGMSLAGANGSDSSRSNTPTPSLAGSLA
DALLARKNAMARKDDEEDW
Download sequence
Identical sequences jgi|Crypa1|91373|estExt_Genewise1Plus.C_41245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]