SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83319352|ref|YP_424026.1| from Mycoplasma capricolum subsp. capricolum ATCC 27343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83319352|ref|YP_424026.1|
Domain Number 1 Region: 419-509
Classification Level Classification E-value
Superfamily PTS system IIB component-like 9.94e-22
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|83319352|ref|YP_424026.1|
Sequence length 517
Comment PTS system mannitol-specific transporter subunit IIBC [Mycoplasma capricolum subsp. capricolum ATCC 27343]
Sequence
MDSKIQINHKEWANKFKLKIQKTGSFMAGMIMPSIGILLAWGLWTAMFLYDFDHNKKLGW
FDAPMLGRLVEPGIKWLLPILIAFNGGRLVYGLRGGMIATFIIVATITGTDYIYGHYILQ
KVGDKWVHPGSPNQFIGAMIVGPLSALFLKKVEKLYLHKINPGLEMLVKNFGLAIYAIVL
GLGLFWSWGWIMWGITFVMISIIKLFGDNKWVAPLLGLFTEPIKVSFLNNALNHGVLGPI
GYNEIQIQRSNGVANPRSIFFLYDPNPGPGLGLLLAYIIFTKKEDRYNATASSLIHTIGG
IHEVYFVFIIKKPKMLLATMLGVVGAQFITSYLGGGTIGTPSPGSLISLIALSNGTHALL
INLLAFVVGTLIAFGISVLLLLKDKKHLQTESNQGFKITDEGIEFSNNKNQEEKINNSDI
KKIVVACEAGVGSSAMAAGLIRKWVNNNNYDIQVTNLAVKDLKDEYDVVITMKSFKDFAQ
QKAPSAYIYPVEQFIGKNIYDDLYKMIKNKQEIREGK
Download sequence
Identical sequences Q2ST87
gi|83319352|ref|YP_424026.1| 340047.MCAP_0028 WP_011386931.1.66603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]