SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83319418|ref|YP_424095.1| from Mycoplasma capricolum subsp. capricolum ATCC 27343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83319418|ref|YP_424095.1|
Domain Number 1 Region: 175-704
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.58e-170
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000000000326
Further Details:      
 
Domain Number 2 Region: 15-174
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 2.88e-61
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|83319418|ref|YP_424095.1|
Sequence length 720
Comment ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma capricolum subsp. capricolum ATCC 27343]
Sequence
MNENKNTIVLDDVDDEYIKLNARSKIFSKDQDNFQLDIKAAELYLKNYIEPRMKKFSSLK
ERLDYLLENQYYDSEILNKYSFDQISQLNDYAYSFNHHFPSFMGALKFFNAYGLKTFDTT
MYLETYTDRVLMNALFLGNGNFTKAKNLLKDMMLGRFQPATPTFLNAAKKHRGEYVSCYL
LRTEDNMESICRTISTSLQLSKRGGGVAICLTNLRETGSPIKNISGLSSGPIPVMKILED
SFTYADQLGQRQGAGAVYISAHHPDIISVLDTKRENADEKIRIKSLSLGLVIPDITFELA
RDNKDMALFSPYDVQKVYGKPLSDISITEKYYEMLENPNIKKTYISARKFFLTVAELHFE
SGYPYILFEDTVNRRNAHDKKGRIIMSNLCSEIVQVSTASEYSSDLSFIKTGEDICCNLG
SLNIDKMMKSGKEFSDSIYNAISALDIVSRNSDLSASPSIKKGNAENHAVGLGAMNLHGF
LATNKIMYDSPEAVDFTNMFFYTVAYNAFKASNKLAQEFEKFASFDQSRFADGSWFDKYT
KCEFDKWTPQTNRVKELFKDYDVQIPSQTDWIELVEEIKKTGLANSHLMAVAPTGSISYL
SSCTPSLQPVVSTVEVRKEGKLGRVYVPAYQINFDNMGYYAMGAYELGPDPIINIVAAAQ
QHVDQAISLTLFMTDKATTRDLNRAYVNAFKQGCSSIYYVRIRQDVLEDSENYECDACKI
Download sequence
Identical sequences A0A0C2VFK4 Q2ST18
WP_011387000.1.63188 WP_011387000.1.66603 340047.MCAP_0101 gi|83319418|ref|YP_424095.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]