SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83319552|ref|YP_424190.1| from Mycoplasma capricolum subsp. capricolum ATCC 27343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83319552|ref|YP_424190.1|
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Ribosomal protein L20 1.96e-45
Family Ribosomal protein L20 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|83319552|ref|YP_424190.1|
Sequence length 119
Comment 50S ribosomal protein L20 [Mycoplasma capricolum subsp. capricolum ATCC 27343]
Sequence
MARVKYGKVTRARRKRWIKLAKGYFGTKKSSYKKAHEQVIRSMAYAFIGRKERKRDFRSL
WIVRINAAVRPEGLSYSTFMHGLKLANININRKMLSELAINNSEEFKQIVQQAKKALNK
Download sequence
Identical sequences A0A014L4F0 A0A084ERG8 A0A0C3A008 A0A1D5B3X6 F4MP91 Q2SSS3
gi|83319552|ref|YP_424190.1| gi|331703215|ref|YP_004399902.1| 340047.MCAP_0203 WP_011387092.1.28854 WP_011387092.1.29233 WP_011387092.1.32284 WP_011387092.1.32760 WP_011387092.1.3902 WP_011387092.1.51242 WP_011387092.1.58029 WP_011387092.1.63188 WP_011387092.1.65728 WP_011387092.1.66603 WP_011387092.1.71627 WP_011387092.1.77628 WP_011387092.1.84933 WP_011387092.1.90090 WP_011387092.1.98664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]