SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83319638|ref|YP_424504.1| from Mycoplasma capricolum subsp. capricolum ATCC 27343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83319638|ref|YP_424504.1|
Domain Number 1 Region: 152-335
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.8e-51
Family G proteins 0.0000123
Further Details:      
 
Domain Number 2 Region: 2-158
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 1.31e-49
Family Obg GTP-binding protein N-terminal domain 0.00000875
Further Details:      
 
Domain Number 3 Region: 361-433
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 1.7e-19
Family Obg GTP-binding protein C-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|83319638|ref|YP_424504.1|
Sequence length 433
Comment GTPase ObgE [Mycoplasma capricolum subsp. capricolum ATCC 27343]
Sequence
MKFVDSADLIIKAGKGGDGAVSFLHALFVPNGGPNGGDGGDGGSVYFQGDEGKHSLLDLK
LQKKYSAQDGFKGDIKNMHGANGEDKIIKVPVGTILYDKKTNTILADINENNKLVLIAKG
GKGGKGNARFANSRNKAPTIFEAGELGQEFEIRAELKVLADVGFVGLPNAGKSTLLRAIS
NSKPVVADYPFTTINPQLGVARTKNNDTFIVADLPGLIQGASLGKGLGHQFLKHIERCLV
ICHIIDASGNFGSEDIIKNYELIRNELKAYNLNLEKRAEIIVLNKMDLDEAQLNLLDEKI
INYFKNKKVVQISGLKKENIDQLLFMIYEELKIAKKQPLWELDKNNDQDEIAIYKFEEQK
EDIQVYNKGNNRWEIAGETIFKIYQKFPIWTEDNLLMFNEKLKETGVYETLVKKGIKKGD
FVKVFDYELEWTD
Download sequence
Identical sequences A0A084EM32 A0A0C3A3Q6 Q2SRV9
gi|83319638|ref|YP_424504.1| 340047.MCAP_0532 WP_011387402.1.32284 WP_011387402.1.32760 WP_011387402.1.63188 WP_011387402.1.66603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]