SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83319785|ref|YP_424736.1| from Mycoplasma capricolum subsp. capricolum ATCC 27343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83319785|ref|YP_424736.1|
Domain Number 1 Region: 482-554
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 1.96e-16
Family Glucose permease domain IIB 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|83319785|ref|YP_424736.1|
Sequence length 559
Comment PTS system transporter subunit IIBC [Mycoplasma capricolum subsp. capricolum ATCC 27343]
Sequence
MKSWLSSFRAGLEQFGRAILVPVTVIPLLALIGAIGYTGQAILAQVYPKGIAKPPVGLVL
AIDAIKDLGMIAITNIDFLVAIGLAAGLAKSEKVSAALSGLMAYAAMHLATALILKIVYG
DPSKTEIVFEGVKKTVKDVFGLKIRFGVLSFQYSAFGGMLAGLLGYTVHKYTYKLKFPEV
LSFFGGPKFSPVASTLAGWVFGLGLGYIWVYINKGLYASGEGLRKLGAFSPFLYASAERA
LLPFGIHHVLNFFVYYTPIGARWVGPDGKAIEGAINVALAKLAAGEQISAKNDTWVVNGT
YVTKIFSLTGATLAMFFVIPKANRKVYGSAIISAGAVSMLSGVTEPIEFTFLFVAPVLYL
IHIFLSGFQNMIMYLFNFGSVTTRGSGIITWLIVNPANFRLIQNVWGTWIIGPIMGGIYF
AIFYFMIKKFDYKTPGRQEGGLTHLVSKKEYKELQKEKREIEKLEAESDKKESKKDEIND
EFINNIIIGCGGAENIKIMANCVTRLRVTMHDISKFDKSIVDKTKPYGYKEIGNQVQIIY
GPKVTNIATLVREKLGVES
Download sequence
Identical sequences Q2SR77
340047.MCAP_0787 gi|83319785|ref|YP_424736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]