SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83319837|ref|YP_424558.1| from Mycoplasma capricolum subsp. capricolum ATCC 27343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83319837|ref|YP_424558.1|
Domain Number 1 Region: 513-601
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.0000000000000466
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|83319837|ref|YP_424558.1|
Sequence length 602
Comment PTS system ascorbate-specific transporter subunits IICB [Mycoplasma capricolum subsp. capricolum ATCC 27343]
Sequence
MDFGKYVLNFFTEFIGTPAILVALFAFIGSLLQKKKFTESLTSTIKTAIGFLIIGGGAGI
IAGSIQKLGFAFNLLFQRSGAIANNDVLPGLFLNTSKIVLTGSLIMICAMFLNIVLARIS
KFKYIYLTGHVLFYFSTMFASVMHVAGLNLDEVKNLTTVVISGALLVSIYMVLTPALLNN
HVIRITKNDNLALGHTGSLGYWLSAIIGLGIAKISKKPSRSTEDVNFPKGLAFLRNTNVA
IGITMLLLYLIIYFTTFIVHGYEQMVAHKIIDNGKDVFVQGLLQSLTFAAGVEIVLIGVR
MFIAEIIPSFQGISQKVVPDAKPALDCPIVFPYAPNAVLIGFISSFIGGIIAMGITILIV
NLKGINVDIWIIIIPSIVPHFFVGATCGVFGNSTGGIKGAIIGSFVNGLIISFVPFLFIG
LQLIPNISNNNQHIAWGDGDFLLGLPIGALLRLIGAKSAIWVLLLISIISWLILPIYSFL
TKKINLVKKLDNNNRVKVINKDQKLISKYDLKKQYKIVAVCGQGLGSSLLIEMSLKNVIK
ELDLPIQITHTNLNSFDPTDETILAVVCGIDLQNSINFERKIVLENLLDQDQAKQKIKEF
LS
Download sequence
Identical sequences Q2SRQ5
WP_011387454.1.66603 gi|83319837|ref|YP_424558.1| 340047.MCAP_0590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]