SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83319877|ref|YP_424795.1| from Mycoplasma capricolum subsp. capricolum ATCC 27343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83319877|ref|YP_424795.1|
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 1.01e-36
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00041
Further Details:      
 
Domain Number 2 Region: 165-259
Classification Level Classification E-value
Superfamily PTS system IIB component-like 1.19e-30
Family PTS system, Fructose specific IIB subunit-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|83319877|ref|YP_424795.1|
Sequence length 678
Comment PTS system fructose-specific transporter subunit IIABC [Mycoplasma capricolum subsp. capricolum ATCC 27343]
Sequence
MQIKDLFNQNTSFFKQEFKTKTQIIDFLVSKLFEQKIISKKTVVLNAIKTREKLESTAIG
DGIAIPHALNEAVLKPTVCFMSLKNPIKWNNDDNQLVDLIFMIVTNDQNGNDHMDAIAGL
SSKFLDSNVLNKLREIENFIQLVEIFNDKKELKEEQTNKNEFFDVVGITACPTGIAHTYL
ASDKLTEYAKSLNLSSKIETQGRRGIENQLTDEDIKNAKVIILAHDKAIEGMSRFNNCKV
IDTSTKDAIYNGKELISNFDKHPKLKEIKNIKADDSNIGELSLKKFKDFKGNLLGGVSRM
LPFVVAGGIILGIAFLLDFITGNGNAKGDFGTVNKVSGWFAAAGKTAMMMMVPILGGYIA
YAIVGPQGLMPGVVAGLLADNTGGFAYGTIGSWSGLWKRILPDHLPTSSGFIGAMVGGYL
AAFIVFGLTIGMQKFKKPFHGVRDIVFIPILSLLGISLTMFVLNIPLGYLLYGIQLGLTY
MAKNNLLIILGAIIGLMMCVDMGGPINKIAYVLGTASVSGSFGKEAIFTNIMAASMAGGM
IPPLGIALCTVLFKKVWTSKERDAAKANWLMGSFFISEGAIPFMVTDPKRISVSALSGGF
VTGLLVGAFKITLPAPHGGIFVFPLLNSELFTQHSVAKGMGIALFILAILIGTLVMTLIL
GFWKKVDISKGHLQLVQA
Download sequence
Identical sequences Q2SR18
340047.MCAP_0853 gi|83319877|ref|YP_424795.1| WP_011387679.1.66603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]