SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83319890|ref|YP_424801.1| from Mycoplasma capricolum subsp. capricolum ATCC 27343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83319890|ref|YP_424801.1|
Domain Number 1 Region: 6-165
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 4.45e-37
Family Isochorismatase-like hydrolases 0.0000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83319890|ref|YP_424801.1|
Sequence length 166
Comment pyrazinamidase/nicotinamidase [Mycoplasma capricolum subsp. capricolum ATCC 27343]
Sequence
MKSQNKNKALIIVDYQYDFCDPNGSLYVKNAYTLKSKIEKLAKDLKSQGWTIIATKDFHP
IDHCSFKIWNKHCIQNTKGSELYFDYSDVDLIIEKGVNKDIESYSGFFDDQNNSNGLDEY
LKSKNIDTLKIVGVATEICVKANYDDAVKLGYNVNVDLEYCKGFTD
Download sequence
Identical sequences A0A0C3A2U0 Q2SR12
gi|83319890|ref|YP_424801.1| WP_011387685.1.63188 WP_011387685.1.66603 340047.MCAP_0859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]