SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83319908|ref|YP_424586.1| from Mycoplasma capricolum subsp. capricolum ATCC 27343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83319908|ref|YP_424586.1|
Domain Number 1 Region: 11-84
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 3.53e-17
Family Glucose permease domain IIB 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|83319908|ref|YP_424586.1|
Sequence length 628
Comment PTS system transporter subunit IIBC [Mycoplasma capricolum subsp. capricolum ATCC 27343]
Sequence
MTKQQKQLALIEEIFINVGGKQNIKDVYNCATRLRLTLYDQSLIKLDNLKTLKRTQGCLI
SSGELQVIIGSEVSQITNLLKEQIQVDIDKINGFEIKNSLNENNKKVGLTKRFVKSISAI
FGPLIPFLIGFGLIMALQQILIRIGLVHSIKSDSVFQKDYNVFDLVINTIANSGFKLIGV
MVIWSTTRYLKGNTAIAIALGLIMISPIIPEQGLHLLNIGSWEIVIKPFYSTILVFIFTG
VVISYFQKLMNKYFHSVANFILNPLLSLLIGGLLAFFVIGPIMSIIESYVLKAFNWFVTL
PYGISGLIIGLTWQPLVVLGVHNVLFFTAVADLTTTNNPSIFLAAAFAAAWAQMGATIAV
GIKSKKSVDKSAAIAAALPGIISGPTESCIYAINLPRFKPFILGTIAGGIGGWLISIFNV
GLNNLAGLGGIVGFLAYTDKIVLAIIIDLVSFVLGILITYVFWNEQQVEEILFKDITKEL
KIKTGHYNSKLQTLLIKLKIKKQQTSEKQTKIIRTYKDIDLLSKDIKKLSKQTVKYEKLV
EKLKQLETKNYKIKNNILTKKLEEQKLKLQNQIKTQKDIVIKDSQTNYTKINNYINQLET
LTNKNLKDFKTKYYNAINKIALDYKLIN
Download sequence
Identical sequences A0A0C3A3D7 Q2SRM7
WP_011387482.1.63188 WP_011387482.1.66603 340047.MCAP_0618 gi|83319908|ref|YP_424586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]