SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A6ZQ43|A6ZQ43_YEAS7 from Saccharomyces cerevisiae YJM789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A6ZQ43|A6ZQ43_YEAS7
Domain Number 1 Region: 87-123,152-257
Classification Level Classification E-value
Superfamily TPR-like 0.00000000447
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A6ZQ43|A6ZQ43_YEAS7
Sequence length 292
Comment Conserved protein OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_3004
Sequence
MLKDLVREKLLTIMNTKAYTQFNPEQLLQLENEMKIYMKSGDSGLTEGNYFFLMEMLFYV
LVYRNQDVDAQVVYNTLRDRLGENSYKMVIMKATLLQINGNDKGAIEYLENLLNDDLEYE
TDFVTYVSIAKKLIAIKTTSKNLSQESVLKEVVALTDKFPLDAELWWYASEIYFEMGQFE
KARYCLEQVLCITPFNYACFGRLSETLYYEALRSKKQTKTELLEKALKNALRSVELSELY
LKGWALVNIISRELGRNKQNDLIKLSASKLNEISAKSNNKDKITAELILNKI
Download sequence
Identical sequences A6ZQ43 C7GMB9 E7NJG9
YJR088C YJR088C YJR088C YJR088C tr|A6ZQ43|A6ZQ43_YEAS7 YJR088C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]