SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RPRC000705-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC000705-PA
Domain Number 1 Region: 64-299
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.29e-54
Family ABC transporter ATPase domain-like 0.00016
Further Details:      
 
Domain Number 2 Region: 3-51
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0000000000127
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) RPRC000705-PA
Sequence length 323
Comment pep:novel supercontig:RproC1:GL551709:10007:10978:1 gene:RPRC000705 transcript:RPRC000705-RA description:""
Sequence
MNLSADHRWLLPGSALAGAGLLIAADTLARMVLAPAEIPVGLLTSLIGSPYSYGSLSRTR
DEPMTNRLMAQHLHYQVAGRTLIDDVSLDINCGEIVAIIGPNGAGKSTLLRLLTGYLAAD
SGECQLAGKALADWQPDALAQTRAVMRQHGALNFPFSVCDVVAMGRAPYRHDCAGDSVVD
YVMALTECTALAQQDYRHLSGGEQQRVQLARVLAQLWHPTPTPCWLFLDEPTSGLDLYHQ
QHLLRLLKLLTQQQPLAVCCILHDLNLAALYADRIALLHQGKLVAQGTPPAVLQSEKLTQ
WYQADVLVHPHPDDATPQVFLRR
Download sequence
Identical sequences RPRC000705-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]