SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RPRC000942-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC000942-PA
Domain Number 1 Region: 69-177
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.12e-21
Family C-terminal domain of adrenodoxin reductase-like 0.0000182
Further Details:      
 
Domain Number 2 Region: 255-317
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 0.000000000879
Family FMN-linked oxidoreductases 0.00037
Further Details:      
 
Domain Number 3 Region: 68-87,176-244
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000114
Family C-terminal domain of adrenodoxin reductase-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) RPRC000942-PA
Sequence length 318
Comment pep:novel supercontig:RproC1:GL562338:838:5333:-1 gene:RPRC000942 transcript:RPRC000942-RA description:""
Sequence
MEEGCDAIFIGIGLPQPKTIPIFQNLTPDMGYFTSKSFLPKVSKGSKPANTPPLFPIIGM
CCNLKLPQLYGTTVVLGAGDTAFDCATSALRCGARKVFVVFRRGFTNIRAVPEEMQLAWE
EKCEFMPFLTPKQVILKDGRISVIEFYRTEEQQDGTWTEDKEQILKLKADFVISAFGSNL
SDKSVIEALKPLNLTEHGVPSLDPISLSTSVPGVFCGGDITGYTETTVEAVNDGKNAAWN
IHKHIMEKNGHQLDSTPSLPKFYTNIDSVDLSVEICGVKFENPFGLASAPPTTASSMIRR
AFEQGWAFAVTKTFALDK
Download sequence
Identical sequences T1HA86
RPRC000942-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]