SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RPRC003223-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC003223-PA
Domain Number 1 Region: 312-408
Classification Level Classification E-value
Superfamily L30e-like 0.00000000000766
Family L30e/L7ae ribosomal proteins 0.019
Further Details:      
 
Weak hits

Sequence:  RPRC003223-PA
Domain Number - Region: 410-479
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00214
Family MgtE N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) RPRC003223-PA
Sequence length 480
Comment pep:novel supercontig:RproC1:GL562978:42166:52034:1 gene:RPRC003223 transcript:RPRC003223-RA description:""
Sequence
MLNFKKVLLGDHNLDGEQSRWPELGSVEQVNLSNRAENDIPSPGDVKDSSVNINDSLYHN
FVIPSQVGFSNNFTCNFPKLTDSFKKQGSKNKACNLRSPCGDESSDSTSSQVKKEKISPS
KMKKPKTPSKANLTVDINVMLKISLNLAASRHQRKRLKYACKRSLKEHVKNVACGNKLDS
DCPVKHKGKKRPHRRRKVTSIKRGFQWAAEKLKRNRPARSYYMKRMRRLRQVILAGMAAE
QDIDGLVSNVGRMKINETQDGQFETQPTLLTSLDIAKSIIHTKKFRPYCNHLLKSSLKTK
AEEFISTLRTYQDRMYYRDPVNSKARRRYVCGCHEARKFLRIQAVKMLFMANNLAVDNGI
PPILEEILQKAEESQLPVIYAGSAFDLGYWTLKKNKTSVIAILNYDGAEVSMFLFLFKVV
QAKLYGEILCELSEAMKQYQLLLNQIQNHLVSNHHSTLDKVTLLQQMEQEIRKNLIAQLS
Download sequence
Identical sequences T1HGQ0
RPRC003223-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]