SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RPRC005259-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC005259-PA
Domain Number 1 Region: 36-68,101-140,182-407
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.07e-53
Family Myotubularin-like phosphatases 0.014
Further Details:      
 
Weak hits

Sequence:  RPRC005259-PA
Domain Number - Region: 459-486
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0361
Family H-NS histone-like proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RPRC005259-PA
Sequence length 647
Comment pep:novel supercontig:RproC1:GL563041:1056052:1065545:1 gene:RPRC005259 transcript:RPRC005259-RA description:""
Sequence
SVMEEITVGEIQELLQHFSRNTFKARDCDAVCQRVMQKCIELVSFDYSYVIISNSNGELS
AHYPSQLIVMEYERTSHNGAAPTTPSTPSRKPSFFESVHDIARLKELFSKARFARCRARF
PLPVILYKGKNICRSATLSGGPEIYGRSGLDYLFCGDDPCEPLDNMSPTLGQCDTSMHGD
PQPQQGDWQLFDRVRSQDIRLLHTLNVGAIIDFMVEKKKVKFGVNVTSSEKVDKENRYSE
FTIISLPYPGCEFFKKYRDNDYVAKGLVFDWSQGHVDANIGIPDDNIASQLKIDWHNYKM
WDLVKLTQNYMQLVLKYVVEGRLGLLIHCISGWDRTPLFVSLLRLSLWADGAIHQTLSPQ
QILYFTIAYDWMLFGHNLEDRLSKGEDIFFFCFYFLKHIVGEDFSISRWTCKTRGSSVLR
TDSDSQLEGLLLDADAPISSQDSNVSLNSSWSSISSKSQDTPPVYFHSDDHSVSWSGSGP
PPTGYPHIVQVTSASSTSPSTYSSVTRAQTSRTSPVAVPSRASSLRHRNESTSSLSTGSW
QFISGTGSLRGSGSNSTCGSHISSNNSRTPFENQFLGESTTTIIEDDFILRALRRERLRN
VRTLFYNCYCSTVGFKLKDGSEASGLGHILGNFAEKVGIISGQRTSL
Download sequence
Identical sequences T1HMI5
RPRC005259-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]