SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RPRC006459-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC006459-PA
Domain Number 1 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.43e-18
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0002
Further Details:      
 
Domain Number 2 Region: 3-52
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 1.94e-16
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RPRC006459-PA
Sequence length 113
Comment pep:novel supercontig:RproC1:GL549011:2002:3132:1 gene:RPRC006459 transcript:RPRC006459-RA description:""
Sequence
MTYQLYRNTTLGNTLQESLDELVQYGQIPTHLAAKVLLQFDKCINNALATRVRSRLTFKA
GKLNTYRFCDNVWTFMLNDVEFREVQEVARVDKVKIVACDGKSFGDESSSTKR
Download sequence
Identical sequences A0A0P4VKG8 R4FMM2
RPRC006459-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]