SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RPRC010522-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC010522-PA
Domain Number 1 Region: 15-157,318-375
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.77e-22
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0043
Further Details:      
 
Domain Number 2 Region: 150-254
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000000000000011
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0021
Further Details:      
 
Weak hits

Sequence:  RPRC010522-PA
Domain Number - Region: 242-319
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0111
Family Tetracyclin repressor-like, C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RPRC010522-PA
Sequence length 375
Comment pep:novel supercontig:RproC1:GL555914:2685:3809:1 gene:RPRC010522 transcript:RPRC010522-RA description:""
Sequence
MWQKNTANCYQNNIAWLYHGGHAVKRAHQLKQRSGSGLVVKQYQKAKALGVVIEQCTKLE
RLIIDSQGRVLGAEVRRGYKFPDDASGSIAFIRATKGVVLASGGFSQGVALRQMYDPRLT
DAFTSTNQPGATGEALMAASMIGALATQMDWIQFGPWSSQDEQGFGYIPQFVERVVGYGL
MVDPANGKRFFKETGNRKERADAIIQLGHPALIIADKTNTLEEVAQAYGMQAAAFVEQVK
RWNGYVEQHQENDPYLGCIANRLKNDYNQCPDMWQKNTANYYQNNVAWLYDFQRCFAQYH
AALLCGAPLAARSPHHGGLAINKDAQVIGFDLKPIVGLYAAGEAAGGVHGAVRLGSVAMT
DCTVFGRIAGKNVVK
Download sequence
Identical sequences T1I2K3
RPRC010522-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]