SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RPRC010812-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  RPRC010812-PA
Domain Number - Region: 23-94
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0144
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RPRC010812-PA
Sequence length 114
Comment pep:novel supercontig:RproC1:GL562986:449337:451228:-1 gene:RPRC010812 transcript:RPRC010812-RA description:""
Sequence
MAIDHYGIMYAVLVGSGGAYGYMKSGSVPSLAAGLIFGTLLGVGAFQVSRNADNYQLSLG
TSALLGGLMGYRYYNSGKIMPAGLLAGISVAMAVRYGSMAFFSNKEFKTENIKN
Download sequence
Identical sequences R4G7R9
RPRC010812-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]