SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RPRC010869-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC010869-PA
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Hsp33 domain 1.44e-60
Family Hsp33 domain 0.0000000921
Further Details:      
 
Domain Number 2 Region: 178-233
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 2.62e-18
Family HSP33 redox switch-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) RPRC010869-PA
Sequence length 243
Comment pep:novel supercontig:RproC1:GL567477:1005:1736:-1 gene:RPRC010869 transcript:RPRC010869-RA description:""
Sequence
MLAATSLLTATLKLNGDITVQLQGDGPLKLAVINGNNQQQMRGVARLQGEITPNATLRDM
VGNGYLVITITPEEGERYQGVVGLEGDSVASCLENYFLQSEQLPTRLFIRSGEHEGRPVA
AGMLLQVLPAQHVGHDDFDHLVQLTTTIKNEELFTLPANEVLYRLYHKESVTLYEPQAVS
FHCHCSRERCADALMTLSDADLHEMLEQEQEIDMYCDYCGTHYSFSASEISDIRHANADA
TRH
Download sequence
Identical sequences T1I3K0
RPRC010869-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]