SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RPRC014516-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  RPRC014516-PA
Domain Number - Region: 28-93
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00129
Family Tetracyclin repressor-like, C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RPRC014516-PA
Sequence length 161
Comment pep:novel supercontig:RproC1:GL562464:405491:417934:-1 gene:RPRC014516 transcript:RPRC014516-RA description:""
Sequence
MSYGSVLVVLLVACYGGASVFSGMTGQLGRALQRLARAGPEPYKLMPGLTLAPTAHWNHT
RPTAHPRGPTLIESVTDVLRTHRLQWKVAPGLQVSLLADDKGMFRVQAGSDNAFQDSSRT
FGMMRRMKLALLPIMYKLGVITTLLVLLTAFALKGLTIGIL
Download sequence
Identical sequences T1IDZ6
RPRC014516-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]