SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RPRC002125-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC002125-PA
Domain Number 1 Region: 31-269
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.82e-48
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00096
Further Details:      
 
Domain Number 2 Region: 603-852
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 8.63e-39
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.01
Further Details:      
 
Domain Number 3 Region: 283-612
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.96e-35
Family Lipovitellin-phosvitin complex, superhelical domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) RPRC002125-PA
Sequence length 882
Comment pep:novel supercontig:RproC1:GL563091:9278855:9287617:-1 gene:RPRC002125 transcript:RPRC002125-RA description:""
Sequence
INKIFIYFKNVTDARKCNLNCVGTTGNLLKFHPGKTYQYKLEGHSVTTLPGAKDETSKVG
IAANVEVSAAGECEHVLVVSGVHTTASDGKKYNLDKTLGSTPLKFALQNGKVVDLCTSET
ESKAALNVKRAVLSLLQSSVLKESGYAFQHETDVFGNCPTNFEFVKHGKSVIVRKTKDLT
KCAYREHLNLQFSLTSYFIPSDRQSTPLLLGSLSTEQKLEGGLLQHASSEEVYNYNPLSA
AEAAYKVQVNTKLTFVGQIDKPAPPTNANSGKSLVFQEDHPEAQKGGVQTMVELLRSSCD
SRIVTEDGASKFSRLVRVMGDSPKEELLQVYRQVKSGQGFKEKDVAKKMYMDAVVQANSA
SSVEVMAELLKRKEVTGSKAQYFYLLLGSVKHATRAALLAVKSLLEEDTSPELYLGAGAL
GGRFCREHNCAKFSEVEAFQTKLAAPLLTKGCKPNNKNEEDALLASLKGLANMKYLTKTV
ASKLADYAGDSELKARIRVALFETIKSDPNKPEFKTVAGEVFKNPLEDSEVRIKAYLVLA
ECPCGKVAALVKTVLENEKSYQVGSFVTSHLRNLRASTYPGKDHAKHHLGAIVNTQKYPV
DFRKYSQNFENSYNLDFINLGAFAESNVIYSQESYVPRSVSLNLTTNFFGHALNWFEVNI
RAENLEKELERVFGPRGKLRKHKYHEVYEEGSEYATSLLENAAERYEKSFRPKRSVSHDQ
LNALANKVNLHREADDDVDVDVSLKLYGNELFWVKYHGEENSPDLGKGMNKLFEGLDDSL
KSAKELNFDYRKHVTFLDGEIIYPTGLGLPLKLKALGSTAFRLKLDGKFDFAALVKDPKN
TDVRLQVLPRLLTFQFLNISMYSFLFQVMSYIYIYIYILDTG
Download sequence
Identical sequences T1HDK5
RPRC002125-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]