SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RPRC002982-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC002982-PA
Domain Number 1 Region: 28-198
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.88e-18
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) RPRC002982-PA
Sequence length 217
Comment pep:novel supercontig:RproC1:GL562972:136991:139572:1 gene:RPRC002982 transcript:RPRC002982-RA description:""
Sequence
MSTSERDGILFVYLNNAVTSEVTLFPVQKELTYFWQVEVSSGTVIPTVLDVSWNLEALVT
VQQTEQNSTFFKITLLNNRTTIEDAAAMQLSFCGTFDNGDFTTITVSKKDELWSINMKRA
LLTLLQLKIPRIEEELSFIDEEAGIYGKCTVEYGVVDYGYKKVHKNVDHDSCKSMPIEES
ANCATNLCPSSYQVHTSFNHVYSFARSAFLQNKVTLY
Download sequence
Identical sequences T1HG10
RPRC002982-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]