SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for RPRC011615-PA from Rhodnius prolixus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RPRC011615-PA
Domain Number 1 Region: 481-578
Classification Level Classification E-value
Superfamily TAFH domain-like 1.57e-29
Family TAFH domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 804-852
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000301
Family TBP-associated factors, TAFs 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RPRC011615-PA
Sequence length 1018
Comment pep:novel supercontig:RproC1:GL563176:3482119:3492011:1 gene:RPRC011615 transcript:RPRC011615-RA description:""
Sequence
MASAKFLEEALSTDVDESAVNAIVGSLETQLVTSSPAVPSQQGHTISVQQNHVNSTISNG
ARGSTMKHGVSNGGAESMNILLNAEPSKSATSEHHNAVNTRVVASLQAGAPSGQYINQVG
NSIGIVQSVPDVNKSQDGVKLVYPSNNQSGISVNNRVCYTNQNVTLPNGNIGLTSNAVLQ
TSAQSFSQAGSCVNKVSGQSGMEQPKPTGTALVIKSGVNSSQSASPIATMTLTGNTNSIG
VATSTGVPGVVTLTKPLTQAVGTQQTIVGGTPQIVPTNVQILNVNALRAATPGQGGGKTL
PQRVMIGTPQMVGGRPVQSGQITLQAFQGLGPGTQGHLLLKTENGQYQLLRVAAPSAQQS
QTIAGNNINTFRVQTIAVSEPYTAATTQGSTQVHTQVSPAQATQGTTTAVQVSVSKVNCL
VHRSFKKRKVGPLLFVIALSIDSSVRHSKKVQLQKRRLKKTIYLFLIERSSSYTKRCSRS
DKRKMPKFLANLLELSSREPKTVERNVRSLIQELVDMKVEPEQFCDRLERLLNASPQPCL
IGFLKKSLPLLRQSMVNNELVIEGIRPPSASVVFPAATPPQTTQVCLICFLMKIGSLQMA
TSQMRVIAQPQVRPGQQIQRIMTTVSGPVYLLSLFELIQHHYKKLKTLVVDKLMKINKNK
LRLLGNIHYCTVELLNSVVKTVSEALIGVGSETLSKLIKIFKCLSLAITKKRNPKVFFTS
LIRTSSRIIVILLWVKIKNSSLVIADRYAGKIWDKLNHVMGMGDDDINDVAAMGGVNLAE
ESQRILGSTEFVGTQIRSCKDEIFLHSVPLVNKIAQIANKYGLEEPALDVAALVSHATQE
RLKTFVEKLAVIAEHRIDLNKADPRYEITQDVRSQLKCLEEIDKAERKRHEEQERELLLR
AAKSRSKPEDPEQAKLKAKAKEMQRAEMEELRQREANLTALLAIGPRKKPKLDENSNSSI
SGVGPSSSTSTNVSINVRVLQMVLRPRVKRVCMRDLLMLMEQERETCRSQLLYRSYFK
Download sequence
Identical sequences T1I5P6
RPRC011615-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]