SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|YALI0E15268g from Yarrowia lipolytica CLIB122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|YALI0E15268g
Domain Number 1 Region: 59-167
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.2e-35
Family Frataxin-like 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|YALI0E15268g
Sequence length 176
Comment some similarities with uniprot|Q07540 Saccharomyces cerevisiae YDL120w YFH1 regulates mitochondrial iron accumulation [Yarrowia lipolytica] Complete CDS. YALI0E15268g
Sequence
MSLIRSLRTVPRIALATRVATGVASLPLRRPLTTGVRRATRTITLPHITTHHETLRLYSL
QATELELEDYHIQADEYLESILIAYEEYAEEVDSNELDVDLAQGVMSLEIPGAGSYVINK
QPPNKQIWLSSPISGPKRYDYVDGEWVYLRDGTTLTELLETETSEAFASTGKKFHL
Download sequence
Identical sequences Q6C5T7
4952.Q6C5T7 XP_503975.1.88470 gnl|GLV|YALI0E15268g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]