SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|YALI0F07623g from Yarrowia lipolytica CLIB122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|YALI0F07623g
Domain Number 1 Region: 224-304
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.18e-23
Family Middle domain of MutM-like DNA repair proteins 0.0038
Further Details:      
 
Domain Number 2 Region: 2-88,153-208
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.23e-20
Family N-terminal domain of MutM-like DNA repair proteins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|YALI0F07623g
Sequence length 446
Comment similar to DEHA0F13101g Debaryomyces hansenii and uniprot|O93997 Candida albicans [Yarrowia lipolytica] Complete CDS. YALI0F07623g
Sequence
MPELGEVAHAASVFAKFATGKKVAEADVQPDKIVFGSETGHEALQKALQGRVITNVSRHG
KYWWLTLDGDADNAVLLHFGMTGYISVKGHRTHYIMMENGGDKKARDRLDRIRGDGGVVE
EKAANGQSIIAANGGDIPEDVSMLEELAEEELEQQTWPPRFVKMDLTLEDGTKLAFYDAR
RLARVKLFTIAEPLDIYKVDPMKKLGPDYSKSPDDEHTPAALKPLDLDAFKAKIQAKKAP
IKSVLLDQSLFSGVGNWVADEILYHSRVHPARMCNLLLESQIDELYTQLVHICQFVVKVE
GNTLLFPLNWLMLNRWGKRNKNKKSYTLEGYEVDHVTVGGRTSSFCPELQHNGPPKEKTT
TKRVKFDGIKTDDEEEQPKELTRTVKEEGEEAEAEETTQTKPKKRRKKVKVEEDLLPLVD
AVEAKDKSILDAQANSRAERAKRRRS
Download sequence
Identical sequences A0A1H6PLY3 Q6C2I5
XP_505127.1.88470 gnl|GLV|YALI0F07623g 4952.Q6C2I5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]