SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|YALI0F02387g from Yarrowia lipolytica CLIB122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|YALI0F02387g
Domain Number 1 Region: 138-433,475-615
Classification Level Classification E-value
Superfamily ARM repeat 6.78e-21
Family Armadillo repeat 0.07
Further Details:      
 
Domain Number 2 Region: 832-1099
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000412
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 3 Region: 1057-1224
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000242
Family Tropomyosin 0.0011
Further Details:      
 
Weak hits

Sequence:  gnl|GLV|YALI0F02387g
Domain Number - Region: 1373-1504
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000418
Family HBL-like 0.025
Further Details:      
 
Domain Number - Region: 716-877
Classification Level Classification E-value
Superfamily Tropomyosin 0.000981
Family Tropomyosin 0.0024
Further Details:      
 
Domain Number - Region: 1224-1411
Classification Level Classification E-value
Superfamily Tropomyosin 0.00222
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number - Region: 4-120
Classification Level Classification E-value
Superfamily ARM repeat 0.0101
Family Armadillo repeat 0.054
Further Details:      
 
Domain Number - Region: 1691-1883
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|YALI0F02387g
Sequence length 1906
Comment similar to DEHA0C09658g Debaryomyces hansenii IPF 1836.1 [Yarrowia lipolytica] Complete CDS. YALI0F02387g
Sequence
MNALSGFIRDSQPKTQSADHAIPTLCDRLTHATLLEDRRSAVLALKGLSKEYREAVAAGG
MRGLISALTKDNDDDETVRASLETLLILFLGNDSDDRSTRGSLTRRGLKYISPLLRDTSS
IDFIALWLTDEFSQNNENFATLIGLLSSHDTYIRLYTLKLLAAVVQNRSERVQECILEVP
DGLMNLVAGLDDPTEFVRSECIIVLSSLVLGNADVQKLVVFENAFHRLFSIMDDEGGLQG
GYVVGDCLTLLTHLLRYNVSNQVAFRETSCVSRLAQLLELPPDMEWNEQTTRNCTLALET
CSLFVPEHGSVTRANQDAFLKAGVLFSILRLAFGANSSTPIRSFALITSGNLLRGNHAIQ
ADFAAVDVPYVDVSQPPAVRVPVVMPVILALLKWTLSTQSVHFFDLRVGAAYCLQAYFQG
NHHAKLEFIKQQIDAYNRRNKSGYEEDKKNGIKEETEEDTKEEKETAHHESDYSQYDSVS
DNIIEALVNYDPDMKLNPYRPWFAAVLLLHIIIDCHEAQVELQNVVVGDEDIGEDPVSFI
QAIAGVMVTCLPLQEPRIVFGYAMLLITILYENVGAVSDFLGESSTVEALLAVVSRSQCT
PLMESMCCLILGTCYEFSDVDSAMSRADLYSLLRGSLGADQYLLKTKRLKDSSYFKDFDS
EDILNAEKDDVAGLPKVYFDEIFVELVKENFTRLSRALLKDPSHSAGGKISYELVQSLED
NVKSLTDELEEVSTALSETKSATSAEIKDLKAIRDDLERDLQETDTRLKEARGALESLEG
KFHTKVAAEKQLQTSLEAERKSGSGLQTELADLKKKLQTLTQQKTQLTTQVETLTAAKDK
AESGINKMSKELFQLTRERDGSDKEKKGLQKELAELKKQDSSRRTELTALAANLKQVTAA
RSDFENRLKGLQSEHSETETLKDKLIEKLKSAATQLEDHKSRGANLEGQIRELQGSHEAL
QNSYDELQKSHEQLSSVGKDNESLASELAELKTKLSKIETESSSRADKVSELEKSLSAAE
AQSKSVAAEKEKVSGQIATHEETIKRLKEELSERTAELDKLKSDLASSEKDLASKTKDVS
AKDTEIEKLKSELETANSKLASTAKEVEILTSELKAAKSDACDSETKIKAVESELVEQKS
KVEHLNAELAAKSSSVESGAAELAEKVALVESLTAKLESKDKELATKTEELSAKEKELET
KTSELETKTAELTTKSKELTAKSDEATTYSAKVKELETSSAALEKKQTTLKAMADNLTKD
LAEKTKELVAAKSELESSNTSSKEEVDVLTKKLSDATAEAVELKKSSQAAETEASSKVSA
LEAKLTKASESSKAELDKVNKLLSSFKEKLQTSKDDHSTEVSKLTEQVRESTLKAENFEH
DISSLKDDLAQAEKERDALRTELDTSIKEMENERTSLTKDADSATKELTNKVSMLQTKLD
ELTASHKKALGDSETEAKGLKKEIKAAQAEIKTLEEVKAKYEASQTDIKGLEKQVSELTE
SLETKTSETEAVKTALEEKLEEASSAKSKLETKVTELEKEVADNQGKHGKAASELEASVK
TLKSEISTHKATIDELKKSAETAAADTSSERTELMSKVTELETQLADAKKELDNVKSTHA
DGSKKQASELNELKTKLEEVATANTKLETELKNASAKLEEEQAAKTKLSSDLEAKTKVSA
DFETELKASQTQHDEEVASLKMEIKSLRDEQTSNASSAGEFKGKIEKLEVELKTKETELQ
TKASNLESASSALEAASKELKSKATELESASSELKSKTSELESKTTELKTINTELKDRTS
ELKTKTTELESKSTELKTVSDTQSATEKALAELQSKYDELLKTNKAKSAATKDMVPKSEY
EELMLMITDLDEKVEKYKEKLEEHGVEISDDDDDDDDDDDDDEDDE
Download sequence
Identical sequences A0A1D8NLM5 Q6C359
gnl|GLV|YALI0F02387g XP_504903.1.88470 4952.Q6C359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]