SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mycfi1|41694|e_gw1.17.394.1 from Mycosphaerella fijiensis CIRAD86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mycfi1|41694|e_gw1.17.394.1
Domain Number 1 Region: 1660-1951
Classification Level Classification E-value
Superfamily BEACH domain 1.2e-117
Family BEACH domain 0.0000000658
Further Details:      
 
Domain Number 2 Region: 2010-2265
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.64e-22
Family WD40-repeat 0.0074
Further Details:      
 
Domain Number 3 Region: 1505-1619
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-19
Family PreBEACH PH-like domain 0.019
Further Details:      
 
Domain Number 4 Region: 119-301
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000246
Family Clostridium neurotoxins, the second last domain 0.034
Further Details:      
 
Weak hits

Sequence:  jgi|Mycfi1|41694|e_gw1.17.394.1
Domain Number - Region: 581-602,695-931
Classification Level Classification E-value
Superfamily ARM repeat 0.0397
Family Mo25 protein 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Mycfi1|41694|e_gw1.17.394.1
Sequence length 2277
Sequence
ALLNITLDATSRNTRNAWALWHTGILSDILNNAYSTALPDSLRASLQDTLVSIGRHGLNT
LNDVATLFQRAHESEHARANLLRMLQSSKEPAFIQFDLEPCGFSSIELPSLRSTFPSPIG
YALTAWIRIDEFDANSHTTLFGAFDPSHTCFVLVYLEKDSHQLILQTSVRSPNPSVRFKS
TCFETGVWYHIAIVQRKSSSDPTHSISSLFVNGNFAEQRKCNYPEMPDESASSASSQRRA
RAVQAFFGTGVGVAANPVPHTVHTRWSLASAHLYSVPLTDEFVAVHFRLGPRYCGNLQDC
LGPLLTYRASSELNRYNETLHPEKTDKSDIVLATEGRGSDVVPEHRLLLGISPTAVIEFD
AASNKSQSSKYELDNHASQKWNRLRQKTRHVALNTAVPSINEAIKHSYGTGVMTGDPIAV
IPQSLDDATWCLSGSLPMLMQLLQSANTKHAFLQASEIFFECVKDNWRISEAMEKGQGFG
ILSTIIREKLGFELGQTHGSARKPSSMLSLEDRQTLPQALLELVLDFVGYVKSMPEHSML
VNPMAYRVLLIDFDTWRRCDTPTQKLYYAQFVHFVSGNRNAAFNLRRLSRMRVTKRLIEA
LKSEDVSEEAAGMMIESLRALVDSNASSHSYKDLAMYVAWGLHDARAMPTTTTRSFTPFA
NTVALRQKVGSWPRSQGNSRPSTPGGGGQTPIPGLPRFELALMVLKLLAETVEDDRSIAI
RRFAKAVSPRWLLHLLAESDARVVELTLGIISKAINSLGPEFKAPFMDKNGGFITLKHRL
KPFWKSPAVWTMTFAIFFGRNFPSIWLDQEFSAFHLVEMLGVNDSLRIQNPETLPAIFSM
LEAGLRKVAGDDPPAEAETRTLKNVIQFLGELYDRSVAFRDFAVNSRYLQELLFVLYPLL
AGTDRLSAETELQTEALSFNGEVVKMRPHSNSLDERPPSIRSLDLNSGKSGNRTPSPMTA
NRVAAPKRISSFILVNDRLSATPAQFKAPMAPEAKEPVKINIANSLVESLLELCISLFID
QICYKDKFSGIGLFLKVPPGFKEHQAYFESYVLVNALAQLGAHLRLNQQFLVETRVLTNL
ARYAQHMAEAVSEGWFIDGAQPLLDFTGEILDHLQQPEIANLKAVRLCSQSTNSIRVVFL
KATLWRLAELNEDAAEADVGNFLNKMTYWQTILFSPENQETLFIKLICYLLYHKLCSGVQ
SVRLAAARLWRMVLVQKPTETATILTNTMGPDQRHLSTGFMKLIGMDDDDFLAWVDGNRG
ILDTVFHTSLSKPWEDFVQNENRSSDETAKTRLSKRKEKLRQWQTEESTADDFIHRYEIS
TNHWRSNVHAQERVKLQRAQQDHQEVVNNLYIALAKVDKQIRQPCGLVPDFVAKWQLDET
EAVNRMRMRLVPDTTELKEANYMPKRKASQRTQKDTKLAVNTSVPRVVSDDMGAIPPTPG
SPALMTLDGTGEATEVGRGRSDSVSNSQLLEGGFEMVDDPQVDEDGVLEDKNRKVMTSLQ
RGDMACEGLLVVGQKCLYMQDNFFQRSDGEIVSVSQAPEDERDPYVQLISGKDVGATRTK
HSIGDQETRHWTWLEVLSVSKRRFLLRDVAIEVFFTDGRSYLITCMSSKVRDDLHSAIVG
RAPQVHSTSNVASDDAWRLDTLRNPDEVPKNLGSKFGSLFNHGPTHTATKKWQRGEMSNF
QYLMLVNTMAGRTFNDLTQYPVFPWVLADYTSEELNLENPKTFRDFSKPMGCQTSAREAE
FKDRFKQFAEMGDDNAPPFHYGTHYSSAMIVSSYLIRLQPFVQSYLLLQGGAFDHADRLF
DSIERAWLSASKETMSDVRELTPEFFYLPEFLSNINKYDFGTKQVTGELVSDVKLPKWAK
GDPQVFIQKHREALESPYVSRRLPDWIDLIFGYKQRGEAAVEATNVFNHLSYAGAKDLDK
IENKVEHIATIGIIHSFGQTPHQVFQKPHAYRELERQAEPKLDTLAESLVRLPDAEMTIS
EKVYDFTVAPWQGRLLASGPGTLNVLPDCTRILRWGFSDHSLRFFSSHSKRALGLYENTH
VGPITAATFADSKTLVTGGQDCTIGLWKVTPSRDLVEITPKTYLFGHRTAVAVLAASRVF
STLLSASADGQVILWGLNRFDCVRVLVPAGRPPVQAARLSNVSGHIILCRGANILLYTLN
GHLLVEQKLCDREEEEILCCAFYEGAGSEYLERELILTGHAHGVANVWALTNLSDGSWYL
QLVKRLHHNEHRDGSGRALPVTAVLPAAREVYTGDEEGNVFRWECVVRHTSLSARGI
Download sequence
Identical sequences jgi|Mycfi1|41694|e_gw1.17.394.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]