SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mycfi1|52983|estExt_Genewise1.C_160642 from Mycosphaerella fijiensis CIRAD86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mycfi1|52983|estExt_Genewise1.C_160642
Domain Number 1 Region: 128-466
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.62e-80
Family IF2B-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Mycfi1|52983|estExt_Genewise1.C_160642
Sequence length 473
Sequence
MSEQQQPDVLKAPTEPKAETPAPAEGEQKLSPAELKKRAKAEKQARRAAEKEAKGEPTDN
ASPAVNGNVNSGSSKAPQQGTGQMPVRTRRGSQSAPKEQSKKQDSKNVELFSHLYSQPRR
TNIDGASKDVHPSVVALGFQIASYEICGSSARCVGMLHAFKDAIAEYTTPAGTSLARHMT
AHHLSPQIDYLKSCRPISESMGNAIRWLKKLIAEVDPSTPDYEAIEFLCDSIDQFIRERI
MVTDQAISASACKLIKDGSVVLTYAKSAIIEKTILRAHGEGKDFRVVCVDSRPLFEGKKL
ATSLMHAGLQVEYVPFSGLNRAVADATVVLLGAHSMLSNGRLQSRIGTAAVAMAAHRADV
PVIVCCESVKFSGKVALDSIVLNEIAPAEELLFPQPPAPAPAPSTTGKGSKNEDSDEPKL
KTLNDWKEIPNLQILNLMYDVTPAEYIRMVICEYGSVPPSSVPVVHRLANEGE
Download sequence
Identical sequences jgi|Mycfi1|52983|estExt_Genewise1.C_160642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]