SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mycfi1|71706|estExt_fgenesh1_pm.C_30094 from Mycosphaerella fijiensis CIRAD86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mycfi1|71706|estExt_fgenesh1_pm.C_30094
Domain Number 1 Region: 202-598
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 4.51e-132
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.00000000132
Further Details:      
 
Domain Number 2 Region: 7-196
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.04e-62
Family Inosicase 0.0000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Mycfi1|71706|estExt_fgenesh1_pm.C_30094
Sequence length 598
Sequence
MASEAPQKIAILSVYDKTGLLDLAKGLIKQNVRLLASGGTARLIREGGFPVEDVSAITKA
PEMLSGRVKTLHPAVHAGILARDLASDEKDLAEQNINKVDYVICNLYPFKDTVAKINVTV
PEAVEEIDIGGVTLIRAAAKNHSRVTILSDPEDYHDFLQELAKGEIPEKQRQLYALKAFT
HTADYDTAISEFFRKKYAGDGTQQLSLRYGTNPHQKPASAFVTNSNLPFKVLGGSPGYIN
LLDVLNAWPLVKELDEALGYPAAASFKHVSPAGAAIGVPLSEQEKKVYMVEDIDGLDQSG
LAQAYARARGADRMSSFGDVIALSREVDLPTAKIIGKEVSDGVVAPGYTAEALEILKKKK
GGKYLVLQMDKAYTPPPQEQRTIYGITLTQNRNDALISPSNTFNSIIVPKESNPLPEPAL
RDLTVATIALKFTQSNSVCYALNGQVIGLGAGQQSRIHCTRLAGDKADNWWMRFHERTTG
IKWKKGTKRADKSNAIDLLCSGIVPESGIERSEWEKNFEEVPTPFTAEERQAWLSKLSEV
AVSSDAFFPFTDNVFRVARSGVKYIAAPTGSQNDQACFSTAEQLGITFVEQPIRLFHH
Download sequence
Identical sequences M3A6U8
jgi|Mycfi1|71706|estExt_fgenesh1_pm.C_30094 XP_007928887.1.3604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]