SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mycfi1|88717|estExt_fgenesh1_pg.C_180117 from Mycosphaerella fijiensis CIRAD86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mycfi1|88717|estExt_fgenesh1_pg.C_180117
Domain Number 1 Region: 84-344
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.98e-103
Family NagB-like 0.0000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Mycfi1|88717|estExt_fgenesh1_pg.C_180117
Sequence length 443
Sequence
MPPGSRYHCGEGSITVSNYMRPSLPHHQNVAPSLLPRSHCSAREVRHAWVPMVPTNTTSI
SNRLCSSISSHLAPICSPRKCAIMRLIIRDDKATASKYISDYIIHRIKSFAPTPEKPFVL
GLPTGSSPEGIYKNLVKAHKNGDISFKHVITFNMDEYVAIPREHPESYHSFMYKHFFSHV
DIDPANINILNGNAEDLEEECIAYEEKIKRSGGIELFLGGIGPDGHIAFNEPGSSLKSRT
RVKTLAYDTILANSRFFGNDVNEVPKMALTVGIQTVLDAREVVIIITGPHKALALQKCIE
GGVNHMWTLSSLQLHPHAMIVVDEDATLELQVKTVKYFKSIEQVAASQGFGQALSSEEMV
LKKRDSVLEKLDSPIKSPTNKSFLAPHPEILMGMRRPLTPDFVPDSMHERIPAQQSSVVG
LDGLETKEFPMSAMHERVDSASA
Download sequence
Identical sequences jgi|Mycfi1|88717|estExt_fgenesh1_pg.C_180117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]