SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479143855|ref|YP_007774718.1| from Eubacterium siraeum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479143855|ref|YP_007774718.1|
Domain Number 1 Region: 3-80,166-340
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.87e-56
Family Bacterial dinuclear zinc exopeptidases 0.0000504
Further Details:      
 
Domain Number 2 Region: 70-174
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 2.9e-21
Family Aminopeptidase/glucanase lid domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479143855|ref|YP_007774718.1|
Sequence length 341
Comment Cellulase M and related proteins [Eubacterium siraeum 70/3]
Sequence
MAELFENIKKLCLADGTSGDEGDVTKLILSMLPQECDAKIDPLGNIVVNKKGAKTPKNKV
MLAAHQDEVGFIVTYITDDGNLKFTTVGGINPEVVIGRQLHFKNGTVGVVGGKAVHQRSP
KERDEPVKLDTLTIDIGASSKAEAEKYVSPGDCAYFRSDYTELGNGYLREKALDDRIGCA
IMVDILNKNLPYDVTCVFTVQEEIGTRGAKVAAYTVKPDYAIVLETTTACDFSGNDGEKR
VCELGKGCVVSYMDRSTIYDRELYRLGFEKAKEINVPCQTKTLVAGGNDSGAIHSSVGGI
RTVALSVPCRYLHSPSCMIKKSDVQSTAELAYAMYLALAEK
Download sequence
Identical sequences A0A174ZZA6 D4JRU7
WP_015518168.1.81606 gi|479143855|ref|YP_007774718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]