SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479143881|ref|YP_007774744.1| from Eubacterium siraeum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479143881|ref|YP_007774744.1|
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily YheA/YmcA-like 2.88e-21
Family YheA-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479143881|ref|YP_007774744.1|
Sequence length 137
Comment Protein of unknown function (DUF964) [Eubacterium siraeum 70/3]
Sequence
MDAIKAARELGKAIQADERYVRYNEAMKANDADMELQELIGEFNLARQNVALEMSKSKEE
QNKEKLDTQNKEMQRLYTLVMQNEHMADFTMAKADMDKLLHEINGIIALCCDGEDPDTCE
VQAGGCSGSCSTCGGCH
Download sequence
Identical sequences A0A175A6V1 A0A1Q6NV11 B0MNS8 D4JRX3 D4MKA6 K1RE64 R6RAJ5
gi|479211936|ref|YP_007839718.1| WP_005352016.1.40803 WP_005352016.1.81606 WP_005352016.1.86524 gi|479143881|ref|YP_007774744.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]