SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479143949|ref|YP_007774812.1| from Eubacterium siraeum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479143949|ref|YP_007774812.1|
Domain Number 1 Region: 1-215
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.72e-53
Family PP-loop ATPase 0.0000974
Further Details:      
 
Domain Number 2 Region: 194-279
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000162
Family MesJ substrate recognition domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479143949|ref|YP_007774812.1|
Sequence length 306
Comment tRNA(Ile)-lysidine synthetase, N-terminal domain [Eubacterium siraeum 70/3]
Sequence
MINKGDTVIAAVSGGADSVALLYVLYSLKDELGFSLAACHVNHNLRGEESDSDERFVRRM
CRFLDIPLYTASIKVNDLRQKHDSLEECARRLRYEFFESISKDRLIATAHTASDNCETIL
INMVRGTALSGICGIPAKRDNIIRPLLYNTREDIELYCSENCLDYVTDSTNLSDDYTRNK
IRHKVVPLLKEINPSLFGAISRLSQSVSDDDRYLDKIASELMEKARTADVKYDVGILRTA
DDCILRRIVTMIFKDNDIPPNMKAVESCVGIIRAGQGKINPCQFRFVQIRKKKLFVVTDR
EKFRRN
Download sequence
Identical sequences D4JS41
gi|479143949|ref|YP_007774812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]