SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479143951|ref|YP_007774814.1| from Eubacterium siraeum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479143951|ref|YP_007774814.1|
Domain Number 1 Region: 61-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 3.14e-22
Family Ribosomal protein L9 C-domain 0.00045
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.92e-17
Family Ribosomal protein L9 N-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479143951|ref|YP_007774814.1|
Sequence length 148
Comment LSU ribosomal protein L9P [Eubacterium siraeum 70/3]
Sequence
MKVIFTQDVAGSGKKGEVKEVKDAYARNCLIKKGLAVEATNENLNHLEGQKASAQHKLDV
EAANAKKIKDTIDGKVLTFKAKAGQGGKLFGSVTGKDISALIKRDFGFDVDKRKIVTKSD
IKSFGTFTAEARLFTGIVAQFSVKVEEE
Download sequence
Identical sequences A0A174ZS94 A0A1Q6NU65 D4JS43 D4MKH4 K1T6L8 R6SAH7
gi|479143951|ref|YP_007774814.1| WP_015518255.1.81606 gi|479212004|ref|YP_007839786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]