SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479145490|ref|YP_007776353.1| from Eubacterium siraeum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479145490|ref|YP_007776353.1|
Domain Number 1 Region: 210-408
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.54e-67
Family B3/B4 domain of PheRS, PheT 0.00000358
Further Details:      
 
Domain Number 2 Region: 474-686
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.94e-43
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00026
Further Details:      
 
Domain Number 3 Region: 39-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.94e-36
Family Myf domain 0.0055
Further Details:      
 
Domain Number 4 Region: 695-791
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.88e-24
Family Anticodon-binding domain of PheRS 0.00046
Further Details:      
 
Domain Number 5 Region: 417-482
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000156
Family Domains B1 and B5 of PheRS-beta, PheT 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479145490|ref|YP_007776353.1|
Sequence length 791
Comment phenylalanyl-tRNA synthetase beta subunit [Eubacterium siraeum 70/3]
Sequence
MRWLNDYVKADMPIKEFVADMTMSGSKVETYHKMSDPINNVVVAKVLKLERHPDSEKLWI
CQLDAGRDEPVQIVTAAQNLFEGAIVPACMHNSTIADGTKITKGKLRGVASNGMMCSYAE
LGLTKDDFDYPVADDGILILNNDPDVDSFRMGMDICEALQTDDTIVEFEITNNRPDCLSV
LGLAQEASATFDIPMNYTEPSFKGVDGDITKEISVSVENTKLCSRYMAALVKNVKIGPSP
KWMARRLRASGVRPINNLVDITNFVMLEYGHPMHAFDLRYVEDNRIVVRNAKEGETLKLL
DEMAEPVKLTPEMLIIADGKKPIAIAGVMGGEHSGIMEDTTTVVFEAACFDGVSVRRTAR
KIGERTEASSRFEKGLNPVNAEKALKRALQLIEMLGCGEVVNTIIDENHSEYVPERLKHD
YKWVNEHLGSDISENEQIEILKKLGFGYENGEIIVPPTRIDMHRACDVAEEVARIYGYNR
IPSTIPKLSSQGKRTPEQIFEDKVISLALALGFYEVMTYSFISPKDYELLRMDEKSRKSV
VLRRPLGEDTSVMRTSALTSMMEVVRRNWSNRNLEGRFFEIAREYFPTGENQLPVERDVL
CYALYGNGEDFFTAKGVAEEVMAKLGLKNVVYTAEKNNPTFHPGRCANVTVNGELIGYVG
QLHPEPAANFGVNTEVYCATLSMEVMFNNANGDVKYTALPKFPSTYRDLSLVCNEDVPSG
DIVAVIEKTAKHLEAVRLFDMYKGEQVPAGMKSLSYKLILRKKDATLTDDEADAVVAKVL
KALEDIGVTLR
Download sequence
Identical sequences D4JWI2
gi|479145490|ref|YP_007776353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]