SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479145586|ref|YP_007776449.1| from Eubacterium siraeum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|479145586|ref|YP_007776449.1|
Domain Number - Region: 8-103
Classification Level Classification E-value
Superfamily FlgN-like 0.0111
Family FlgN-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479145586|ref|YP_007776449.1|
Sequence length 159
Comment hypothetical protein EUS_26040 [Eubacterium siraeum 70/3]
Sequence
MKKADAQTLLTLMDELTELMTEYDRRTDRMVTNDLEVIQQVLLSRNELMDKMRQVKQSIM
DMANAQVPAERELIRDILNNKPVTENLSYELRQLQSKMRHLHDIKSGIDEKDKKVTAVVR
QSYEDVKAELESLKVDKKKIDYYSSVKLGGKGRTFNTNS
Download sequence
Identical sequences D4JWS8
gi|479145586|ref|YP_007776449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]